PDB entry 1vcg

View 1vcg on RCSB PDB site
Description: Crystal Structure of IPP isomerase at P43212
Class: isomerase
Keywords: TIM barrel, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2004-03-08, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.24
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746I8 (Start-331)
      • modified residue (65)
      • modified residue (90-91)
      • modified residue (142)
      • modified residue (184)
    Domains in SCOPe 2.07: d1vcga_
  • Chain 'B':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746I8 (Start-331)
      • modified residue (65)
      • modified residue (90-91)
      • modified residue (142)
      • modified residue (184)
    Domains in SCOPe 2.07: d1vcgb_
  • Chain 'C':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746I8 (Start-331)
      • modified residue (65)
      • modified residue (90-91)
      • modified residue (142)
      • modified residue (184)
    Domains in SCOPe 2.07: d1vcgc_
  • Chain 'D':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q746I8 (Start-331)
      • modified residue (65)
      • modified residue (90-91)
      • modified residue (142)
      • modified residue (184)
    Domains in SCOPe 2.07: d1vcgd_
  • Heterogens: FMN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vcgA (A:)
    mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkap
    fligamtggeengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkall
    ianlglaqlrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellpl
    pfpvmvkevghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceig
    iptarailevrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaerva
    awigdyleelrtalfaigarnpkeargrverv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcgA (A:)
    khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
    rinlalaeaaealgvgmmlgsgrillerpvrkvapkallianlglaqlrrygrddllrlv
    emleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalal
    rdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplva
    sggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfaigarn
    pkeargrverv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vcgB (B:)
    mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkap
    fligamtggeengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkall
    ianlglaqlrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellpl
    pfpvmvkevghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceig
    iptarailevrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaerva
    awigdyleelrtalfaigarnpkeargrverv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcgB (B:)
    khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
    rinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkallianlglaqlrrygr
    ddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghgls
    reaalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevl
    phlplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtal
    faigarnpkeargrverv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vcgC (C:)
    mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkap
    fligamtggeengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkall
    ianlglaqlrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellpl
    pfpvmvkevghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceig
    iptarailevrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaerva
    awigdyleelrtalfaigarnpkeargrverv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcgC (C:)
    khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
    rinlalaeaaealgvgmmlgsgrillerpealrrvrkvapkallianlglaqlrrygrdd
    llrlvemleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsre
    aalalrdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlph
    lplvasggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfa
    igarnpkeargrverv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vcgD (D:)
    mnirerkrkhleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkap
    fligamtggeengerinlalaeaaealgvgmmlgsgrillerpealrsfrvrkvapkall
    ianlglaqlrrygrddllrlvemleadalafhvnplqeavqrgdtdfrglverlaellpl
    pfpvmvkevghglsreaalalrdlplaavdvagaggtswarveewvrfgevrhpelceig
    iptarailevrevlphlplvasggvytgtdgakalalgadllavarpllrpalegaerva
    awigdyleelrtalfaigarnpkeargrverv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vcgD (D:)
    khleaclegevayqktttglegfrlryqalaglalsevdlttpflgktlkapfligamte
    rinlalaeaaealgvgmmlgsgrillerpvrkvapkallianlglaqlrrygrddllrlv
    emleadalafhvnplqeavqrgdtdfrglverlaellplpfpvmvkevghglsreaalal
    rdlplaavdvagaggtswarveewvrfgevrhpelceigiptarailevrevlphlplva
    sggvytgtdgakalalgadllavarpllrpalegaervaawigdyleelrtalfaigarn
    pkeargrverv