![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
![]() | Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species) L-alanine dehydrogenase homologue |
![]() | Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries) |
![]() | Domain d1u2db1: 1u2d B:144-326 [119477] Other proteins in same PDB: d1u2da2, d1u2db2, d1u2dc_ automatically matched to d1f8ga1 complexed with gol, nad, ndp |
PDB Entry: 1u2d (more details), 3 Å
SCOPe Domain Sequences for d1u2db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2db1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv psr
Timeline for d1u2db1: