| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
| Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
| Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
| Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
| Domain d1u2db2: 1u2d B:1-143,B:327-378 [119478] Other proteins in same PDB: d1u2da1, d1u2db1, d1u2dc_ automatically matched to d1f8ga2 complexed with gol, nad, ndp |
PDB Entry: 1u2d (more details), 3 Å
SCOPe Domain Sequences for d1u2db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2db2 c.23.12.2 (B:1-143,B:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa
Timeline for d1u2db2: