SCOPe 2.08: Domain d1u2dc_: 1u2d C:

Lineage for d1u2dc_ (1u2d C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
   automatically mapped to Pfam PF02233

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)

8. Domain d1u2dc_: 1u2d C: [119479]
   Other proteins in same PDB: d1u2da1, d1u2da2, d1u2db1, d1u2db2
   automated match to d1e3ta_
   complexed with gol, nad, ndp

Details for d1u2dc_

PDB Entry: 1u2d, 3 Å

PDB Description: Structre of transhydrogenaes (dI.NADH)2(dIII.NADPH)1 asymmetric complex

PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d1u2dc_:

Sequence; same for both SEQRES and ATOM records:

>d1u2dc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d1u2dc_:

• d1u2dc_ first appeared in SCOP 1.73, called d1u2dc1
  
• d1u2dc_ appears in SCOPe 2.07