SCOPe 2.05: Domain d1tfob_: 1tfo B:

Lineage for d1tfob_ (1tfo B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.20: Colicin D immunity protein [101125] (1 family)
   automatically mapped to Pfam PF09204

5. Family a.24.20.1: Colicin D immunity protein [101126] (2 proteins)

6. Protein automated matches [190050] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186771] (2 PDB entries)

8. Domain d1tfob_: 1tfo B: [119234]
   Other proteins in same PDB: d1tfoa_
   automated match to d1v74b_

Details for d1tfob_

PDB Entry: 1tfo, 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein

PDB Compounds: (B:) Colicin D immunity protein

SCOPe Domain Sequences for d1tfob_:

Sequence; same for both SEQRES and ATOM records:

>d1tfob_ a.24.20.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
dranyeiddnglkvevrsilekfklh

Timeline for d1tfob_:

• d1tfob_ first appeared in SCOP 1.73, called d1tfob1
  
• d1tfob_ appears in SCOPe 2.04
  
• d1tfob_ is called d1tfob2 in SCOPe 2.06
  
• d1tfob_ appears in the current release, SCOPe 2.08, called d1tfob2