SCOP 1.73: Domain d1tfob1: 1tfo B:3-87

Lineage for d1tfob1 (1tfo B:3-87)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.20: Colicin D immunity protein [101125] (1 family)

5. Family a.24.20.1: Colicin D immunity protein [101126] (1 protein)

6. Protein Colicin D immunity protein [101127] (1 species)
   tRNA-mimic

7. Species Escherichia coli [TaxId:562] [101128] (3 PDB entries)

8. Domain d1tfob1: 1tfo B:3-87 [119234]
   Other proteins in same PDB: d1tfoa1
   automatically matched to d1v74b_

Details for d1tfob1

PDB Entry: 1tfo, 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein

PDB Compounds: (B:) Colicin D immunity protein

SCOP Domain Sequences for d1tfob1:

Sequence; same for both SEQRES and ATOM records:

>d1tfob1 a.24.20.1 (B:3-87) Colicin D immunity protein {Escherichia coli [TaxId: 562]}
kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
dranyeiddnglkvevrsilekfkl

Timeline for d1tfob1:

• d1tfob1 is new in SCOP 1.73
  
• d1tfob1 appears in SCOP 1.75
  
• d1tfob1 appears in the current release, SCOPe 2.08, called d1tfob2