Lineage for d1tfob2 (1tfo B:3-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700634Superfamily a.24.20: Colicin D immunity protein [101125] (1 family) (S)
    automatically mapped to Pfam PF09204
  5. 2700635Family a.24.20.1: Colicin D immunity protein [101126] (2 proteins)
  6. 2700639Protein automated matches [190050] (1 species)
    not a true protein
  7. 2700640Species Escherichia coli [TaxId:562] [186771] (2 PDB entries)
  8. 2700641Domain d1tfob2: 1tfo B:3-87 [119234]
    Other proteins in same PDB: d1tfoa_, d1tfob3
    automated match to d1v74b_

Details for d1tfob2

PDB Entry: 1tfo (more details), 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein
PDB Compounds: (B:) Colicin D immunity protein

SCOPe Domain Sequences for d1tfob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfob2 a.24.20.1 (B:3-87) automated matches {Escherichia coli [TaxId: 562]}
kmamidlaklflaskitaiefsericverrrlygvkdlspnilncgeelfmaaerfepda
dranyeiddnglkvevrsilekfkl

SCOPe Domain Coordinates for d1tfob2:

Click to download the PDB-style file with coordinates for d1tfob2.
(The format of our PDB-style files is described here.)

Timeline for d1tfob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfob3
View in 3D
Domains from other chains:
(mouse over for more information)
d1tfoa_