SCOPe 2.05: Domain d1tfoa_: 1tfo A:

Lineage for d1tfoa_ (1tfo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
   alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander

4. Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families)

5. Family d.243.1.1: Colicin D nuclease domain [102825] (1 protein)
   automatically mapped to Pfam PF11429

6. Protein Colicin D nuclease domain [102826] (1 species)
   tRNA-specific ribonuclease

7. Species Escherichia coli [TaxId:562] [102827] (3 PDB entries)

8. Domain d1tfoa_: 1tfo A: [119233]
   Other proteins in same PDB: d1tfob_
   automated match to d1v74a_

Details for d1tfoa_

PDB Entry: 1tfo, 2.3 Å

PDB Description: Ribonuclease from Escherichia coli complexed with its inhibitor protein

PDB Compounds: (A:) Colicin D

SCOPe Domain Sequences for d1tfoa_:

Sequence; same for both SEQRES and ATOM records:

>d1tfoa_ d.243.1.1 (A:) Colicin D nuclease domain {Escherichia coli [TaxId: 562]}
ldsgrfsrkqldkkykhagdfgisdtkknretltkfrdaieehlsdkdtvekgtyrrekg
skvyfnpntmnvviiksngeflsgwkinpdadngriyletgel

Timeline for d1tfoa_:

• d1tfoa_ first appeared in SCOP 1.73, called d1tfoa1
  
• d1tfoa_ appears in SCOPe 2.04
  
• d1tfoa_ appears in SCOPe 2.06
  
• d1tfoa_ appears in the current release, SCOPe 2.08