![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries) Uniprot P05979 32-584 |
![]() | Domain d1pthb2: 1pth B:33-73 [118583] Other proteins in same PDB: d1ptha1, d1pthb1 duplicate of 1PTH 33-73 complexed with bog, hem, nag, sal |
PDB Entry: 1pth (more details), 3.4 Å
SCOPe Domain Sequences for d1pthb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pthb2 g.3.11.1 (B:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d1pthb2: