Lineage for d1pthb1 (1pth B:74-583)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins)
  6. Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. Species Sheep (Ovis aries) [TaxId:9940] [48137] (23 PDB entries)
    Uniprot P05979 32-584
  8. Domain d1pthb1: 1pth B:74-583 [118582]
    Other proteins in same PDB: d1ptha2, d1pthb2
    duplicate of 1PTH 74-583
    complexed with bog, hem, nag, sal

Details for d1pthb1

PDB Entry: 1pth (more details), 3.4 Å

PDB Description: the structural basis of aspirin activity inferred from the crystal structure of inactivated prostaglandin h2 synthase
PDB Compounds: (B:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1pthb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pthb1 a.93.1.2 (B:74-583) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvp

SCOPe Domain Coordinates for d1pthb1 are not available.

Timeline for d1pthb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pthb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ptha1, d1ptha2