| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
| Protein Putative arsenical resistance operon repressor AF0168 [116786] (1 species) lacks the extra C-terminal helix |
| Species Archaeoglobus fulgidus [TaxId:2234] [116787] (1 PDB entry) Uniprot O30069 |
| Domain d1y0ua1: 1y0u A:1-87 [116310] Other proteins in same PDB: d1y0ua2, d1y0ub2 Structural genomics target complexed with act |
PDB Entry: 1y0u (more details), 1.6 Å
SCOPe Domain Sequences for d1y0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ua1 a.4.5.5 (A:1-87) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]}
msleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkqldy
hlkvleagfciervgerwvvtdagkiv
Timeline for d1y0ua1: