Lineage for d1y0ua1 (1y0u A:1-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693115Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693132Protein Putative arsenical resistance operon repressor AF0168 [116786] (1 species)
    lacks the extra C-terminal helix
  7. 2693133Species Archaeoglobus fulgidus [TaxId:2234] [116787] (1 PDB entry)
    Uniprot O30069
  8. 2693134Domain d1y0ua1: 1y0u A:1-87 [116310]
    Other proteins in same PDB: d1y0ua2, d1y0ub2
    Structural genomics target
    complexed with act

Details for d1y0ua1

PDB Entry: 1y0u (more details), 1.6 Å

PDB Description: Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
PDB Compounds: (A:) arsenical resistance operon repressor, putative

SCOPe Domain Sequences for d1y0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ua1 a.4.5.5 (A:1-87) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]}
msleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkqldy
hlkvleagfciervgerwvvtdagkiv

SCOPe Domain Coordinates for d1y0ua1:

Click to download the PDB-style file with coordinates for d1y0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1y0ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y0ua2