PDB entry 1y0u

View 1y0u on RCSB PDB site
Description: Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
Class: transcription repressor
Keywords: Structural Genomics, Protein Structure Initiative, PSI, Midwest Center For Structural Genomocs, MCSG, Arsenical Resistance Operon Repressor, HTH_ARSR, DNA-binding protein, Midwest Center for Structural Genomics, TRANSCRIPTION REPRESSOR
Deposited on 2004-11-16, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenical resistance operon repressor, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30069 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (38)
      • modified residue (49)
    Domains in SCOPe 2.08: d1y0ua1, d1y0ua2
  • Chain 'B':
    Compound: arsenical resistance operon repressor, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30069 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (38)
      • modified residue (49)
    Domains in SCOPe 2.08: d1y0ub1, d1y0ub2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1y0uA (A:)
ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
dyhlkvleagfciervgerwvvtdagkivdkirggs

    Sequence, based on observed residues (ATOM records): (download) 
    >1y0uA (A:)
ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
dyhlkvleagfciervgerwvvtdagkiv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1y0uB (B:)
ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
dyhlkvleagfciervgerwvvtdagkivdkirggs

    Sequence, based on observed residues (ATOM records): (download) 
    >1y0uB (B:)
ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
dyhlkvleagfciervgerwvvtdagki