Class a: All alpha proteins [46456] (226 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) contains a small beta-sheet (wing) |
Family a.4.5.5: ArsR-like transcriptional regulators [46801] (3 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Putative arsenical resistance operon repressor AF0168 [116786] (1 species) lacks the extra C-terminal helix |
Species Archaeoglobus fulgidus [TaxId:2234] [116787] (1 PDB entry) |
Domain d1y0ua_: 1y0u A: [116310] |
PDB Entry: 1y0u (more details), 1.6 Å
SCOP Domain Sequences for d1y0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y0ua_ a.4.5.5 (A:) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus} ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql dyhlkvleagfciervgerwvvtdagkiv
Timeline for d1y0ua_: