PDB entry 1y0u

View 1y0u on RCSB PDB site
Description: Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
Deposited on 2004-11-16, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y0ua_
  • Chain 'B':
    Domains in SCOP 1.71: d1y0ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0uA (A:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagkivdkirggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0uA (A:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagkiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0uB (B:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagkivdkirggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0uB (B:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagki