Lineage for d1xx7d1 (1xx7 D:2-171)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014875Protein Oxetanocin-like protein PF0395 [116971] (1 species)
    similar fold and oligomeric structure to 5'-nucleotidase YfbR
  7. 2014876Species Pyrococcus furiosus [TaxId:2261] [116972] (1 PDB entry)
    Uniprot Q8U3R1
  8. 2014880Domain d1xx7d1: 1xx7 D:2-171 [116146]
    Other proteins in same PDB: d1xx7a2, d1xx7b2, d1xx7c2, d1xx7d2, d1xx7e2, d1xx7f2
    Structural genomics target
    complexed with ni, unx

Details for d1xx7d1

PDB Entry: 1xx7 (more details), 2.26 Å

PDB Description: Conserved hypothetical protein from Pyrococcus furiosus Pfu-403030-001
PDB Compounds: (D:) oxetanocin-like protein

SCOPe Domain Sequences for d1xx7d1:

Sequence, based on SEQRES records: (download)

>d1xx7d1 a.211.1.1 (D:2-171) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]}
idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal
kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk
iadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrr

Sequence, based on observed residues (ATOM records): (download)

>d1xx7d1 a.211.1.1 (D:2-171) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]}
idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal
kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk
iadkldmiiqayeyelsgaknlsefeisrylreiieevrr

SCOPe Domain Coordinates for d1xx7d1:

Click to download the PDB-style file with coordinates for d1xx7d1.
(The format of our PDB-style files is described here.)

Timeline for d1xx7d1: