PDB entry 1xx7

View 1xx7 on RCSB PDB site
Description: Conserved hypothetical protein from Pyrococcus furiosus Pfu-403030-001
Class: structural genomics, unknown function
Keywords: PSI, SECSG, protein structure initiative, southeast collaboratory for structural genomics, Pyrococcus furiosus, conserved hypothetical protein, hyperthermophile, structural genomics, unknown function
Deposited on 2004-11-04, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxetanocin-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3R1 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xx7a1, d1xx7a2
  • Chain 'B':
    Compound: oxetanocin-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3R1 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xx7b1, d1xx7b2
  • Chain 'C':
    Compound: oxetanocin-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3R1 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xx7c1, d1xx7c2
  • Chain 'D':
    Compound: oxetanocin-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3R1 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xx7d1, d1xx7d2
  • Chain 'E':
    Compound: oxetanocin-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3R1 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xx7e1, d1xx7e2
  • Chain 'F':
    Compound: oxetanocin-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3R1 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1xx7f1, d1xx7f2
  • Heterogens: NI, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xx7A (A:)
    ahhhhhhgsidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkg
    veidvekalkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyska
    ltlegqlvkiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    kddh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx7A (A:)
    sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
    lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
    kiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xx7B (B:)
    ahhhhhhgsidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkg
    veidvekalkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyska
    ltlegqlvkiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    kddh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx7B (B:)
    sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
    lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
    kiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xx7C (C:)
    ahhhhhhgsidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkg
    veidvekalkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyska
    ltlegqlvkiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    kddh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx7C (C:)
    sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
    lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
    kiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xx7D (D:)
    ahhhhhhgsidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkg
    veidvekalkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyska
    ltlegqlvkiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    kddh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx7D (D:)
    sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
    lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
    kiadkldmiiqayeyelsgaknlsefeisrylreiieevrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xx7E (E:)
    ahhhhhhgsidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkg
    veidvekalkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyska
    ltlegqlvkiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    kddh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx7E (E:)
    sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
    lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
    kiadkldmiiqayeyelsgaknlseflekleisrylreiieevrrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xx7F (F:)
    ahhhhhhgsidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkg
    veidvekalkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyska
    ltlegqlvkiadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
    kddh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xx7F (F:)
    sidlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidveka
    lkiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlv
    kiadkldmiiqayeyelsgaknlsefwnalisrylreiieevrrl