![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
![]() | Protein Oxetanocin-like protein PF0395 [116971] (1 species) similar fold and oligomeric structure to 5'-nucleotidase YfbR |
![]() | Species Pyrococcus furiosus [TaxId:2261] [116972] (1 PDB entry) Uniprot Q8U3R1 |
![]() | Domain d1xx7f1: 1xx7 F:2-172 [116148] Other proteins in same PDB: d1xx7a2, d1xx7b2, d1xx7c2, d1xx7d2, d1xx7e2, d1xx7f2 Structural genomics target complexed with ni, unx |
PDB Entry: 1xx7 (more details), 2.26 Å
SCOPe Domain Sequences for d1xx7f1:
Sequence, based on SEQRES records: (download)
>d1xx7f1 a.211.1.1 (F:2-172) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]} idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk iadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl
>d1xx7f1 a.211.1.1 (F:2-172) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]} idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk iadkldmiiqayeyelsgaknlsefwnalisrylreiieevrrl
Timeline for d1xx7f1: