SCOPe 2.08: Domain d1xx7c1: 1xx7 C:2-172

Lineage for d1xx7c1 (1xx7 C:2-172)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.1: HD domain [101340] (15 proteins)
   Pfam PF01966; metal dependent phosphohydrolases

6. Protein Oxetanocin-like protein PF0395 [116971] (1 species)
   similar fold and oligomeric structure to 5'-nucleotidase YfbR

7. Species Pyrococcus furiosus [TaxId:2261] [116972] (1 PDB entry)
   Uniprot Q8U3R1

8. Domain d1xx7c1: 1xx7 C:2-172 [116145]
   Other proteins in same PDB: d1xx7a2, d1xx7b2, d1xx7c2, d1xx7d2, d1xx7e2, d1xx7f2
   Structural genomics target
   complexed with ni, unx

Details for d1xx7c1

PDB Entry: 1xx7, 2.26 Å

PDB Description: conserved hypothetical protein from pyrococcus furiosus pfu-403030-001

PDB Compounds: (C:) oxetanocin-like protein

SCOPe Domain Sequences for d1xx7c1:

Sequence; same for both SEQRES and ATOM records:

>d1xx7c1 a.211.1.1 (C:2-172) Oxetanocin-like protein PF0395 {Pyrococcus furiosus [TaxId: 2261]}
idlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekal
kiaiihdlgeaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvk
iadkldmiiqayeyelsgaknlsefwnaledlekleisrylreiieevrrl

Timeline for d1xx7c1:

• d1xx7c1 first appeared in SCOP 1.71, called d1xx7c_
  
• d1xx7c1 appears in SCOPe 2.07