Lineage for d1xsjd1 (1xsj D:666-772)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825025Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2825026Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2825027Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (4 proteins)
  6. 2825058Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 2825059Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 2825069Domain d1xsjd1: 1xsj D:666-772 [115963]
    Other proteins in same PDB: d1xsja2, d1xsja3, d1xsja4, d1xsja5, d1xsjb2, d1xsjb3, d1xsjb4, d1xsjb5, d1xsjc2, d1xsjc3, d1xsjc4, d1xsjc5, d1xsjd2, d1xsjd3, d1xsjd4, d1xsjd5, d1xsje2, d1xsje3, d1xsje4, d1xsje5, d1xsjf2, d1xsjf3, d1xsjf4, d1xsjf5
    complexed with trs

Details for d1xsjd1

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjd1 b.150.1.1 (D:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

SCOPe Domain Coordinates for d1xsjd1:

Click to download the PDB-style file with coordinates for d1xsjd1.
(The format of our PDB-style files is described here.)

Timeline for d1xsjd1: