SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1xsje4 (1xsj E:248-585)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083644Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 protein domains)
    Pfam PF01055
  6. 2083661Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 2083662Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 2083673Domain d1xsje4: 1xsj E:248-585 [115970]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja3, d1xsja5, d1xsjb1, d1xsjb2, d1xsjb3, d1xsjb5, d1xsjc1, d1xsjc2, d1xsjc3, d1xsjc5, d1xsjd1, d1xsjd2, d1xsjd3, d1xsjd5, d1xsje1, d1xsje2, d1xsje3, d1xsje5, d1xsjf1, d1xsjf2, d1xsjf3, d1xsjf5
    complexed with trs

Details for d1xsje4

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsje4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsje4 c.1.8.13 (E:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOPe Domain Coordinates for d1xsje4:

Click to download the PDB-style file with coordinates for d1xsje4.
(The format of our PDB-style files is described here.)

Timeline for d1xsje4: