SCOPe 2.08: Structural Classification of Proteins

PDB entry 1xsj

View 1xsj on RCSB PDB site
Description: Structure of a Family 31 alpha glycosidase
Class: hydrolase
Keywords: beta(8)alpha(8) barrel and beta sandwich domains, hydrolase
Deposited on 2004-10-19, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsja1, d1xsja2, d1xsja3, d1xsja4, d1xsja5
Chain 'B':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsjb1, d1xsjb2, d1xsjb3, d1xsjb4, d1xsjb5
Chain 'C':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsjc1, d1xsjc2, d1xsjc3, d1xsjc4, d1xsjc5
Chain 'D':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsjd1, d1xsjd2, d1xsjd3, d1xsjd4, d1xsjd5
Chain 'E':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsje1, d1xsje2, d1xsje3, d1xsje4, d1xsje5
Chain 'F':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsjf1, d1xsjf2, d1xsjf3, d1xsjf4, d1xsjf5
Heterogens: TRS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1xsjA (A:)
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh