Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins) |
Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
Species Escherichia coli [TaxId:562] [117300] (5 PDB entries) Uniprot P31434 |
Domain d1xsjd3: 1xsj D:586-665 [115965] Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja4, d1xsja5, d1xsjb1, d1xsjb2, d1xsjb4, d1xsjb5, d1xsjc1, d1xsjc2, d1xsjc4, d1xsjc5, d1xsjd1, d1xsjd2, d1xsjd4, d1xsjd5, d1xsje1, d1xsje2, d1xsje4, d1xsje5, d1xsjf1, d1xsjf2, d1xsjf4, d1xsjf5 complexed with trs |
PDB Entry: 1xsj (more details), 2.1 Å
SCOPe Domain Sequences for d1xsjd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsjd3 b.71.1.4 (D:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d1xsjd3:
View in 3D Domains from same chain: (mouse over for more information) d1xsjd1, d1xsjd2, d1xsjd4, d1xsjd5 |