Lineage for d1xsjd4 (1xsj D:248-585)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832277Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 2832278Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 2832288Domain d1xsjd4: 1xsj D:248-585 [115966]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja3, d1xsja5, d1xsjb1, d1xsjb2, d1xsjb3, d1xsjb5, d1xsjc1, d1xsjc2, d1xsjc3, d1xsjc5, d1xsjd1, d1xsjd2, d1xsjd3, d1xsjd5, d1xsje1, d1xsje2, d1xsje3, d1xsje5, d1xsjf1, d1xsjf2, d1xsjf3, d1xsjf5
    complexed with trs

Details for d1xsjd4

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsjd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjd4 c.1.8.13 (D:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOPe Domain Coordinates for d1xsjd4:

Click to download the PDB-style file with coordinates for d1xsjd4.
(The format of our PDB-style files is described here.)

Timeline for d1xsjd4: