Lineage for d1xsjc2 (1xsj C:1-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782059Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins)
    Pfam PF16863
  6. 2782093Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 2782094Species Escherichia coli [TaxId:562] [117141] (5 PDB entries)
    Uniprot P31434
  8. 2782103Domain d1xsjc2: 1xsj C:1-247 [115960]
    Other proteins in same PDB: d1xsja1, d1xsja3, d1xsja4, d1xsja5, d1xsjb1, d1xsjb3, d1xsjb4, d1xsjb5, d1xsjc1, d1xsjc3, d1xsjc4, d1xsjc5, d1xsjd1, d1xsjd3, d1xsjd4, d1xsjd5, d1xsje1, d1xsje3, d1xsje4, d1xsje5, d1xsjf1, d1xsjf3, d1xsjf4, d1xsjf5
    complexed with trs

Details for d1xsjc2

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjc2 b.30.5.11 (C:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOPe Domain Coordinates for d1xsjc2:

Click to download the PDB-style file with coordinates for d1xsjc2.
(The format of our PDB-style files is described here.)

Timeline for d1xsjc2: