Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries) Uniprot P13569 389-671 |
Domain d1xmie_: 1xmi E: [115493] Other proteins in same PDB: d1xmia2, d1xmib2, d1xmid2 complexed with atp, mg |
PDB Entry: 1xmi (more details), 2.25 Å
SCOPe Domain Sequences for d1xmie_:
Sequence, based on SEQRES records: (download)
>d1xmie_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]} ttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfki ergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniia gvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdadl ylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfyg tfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfsl
>d1xmie_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]} ttevvmenvtafweegfgelfeksfsnfsllgtpvlkdinfkiergqllavagstgagkt sllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvikacq leediskfaekdnivlgeggitlsggqrarislaravykdadlylldspfgyldvlteke ifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklm gcdsfdqfsaerrnsiltetlrrfsl
Timeline for d1xmie_: