Lineage for d1xmie_ (1xmi E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2112801Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2112802Species Human (Homo sapiens) [TaxId:9606] [117543] (9 PDB entries)
    Uniprot P13569 389-671
  8. 2112815Domain d1xmie_: 1xmi E: [115493]
    Other proteins in same PDB: d1xmia2, d1xmib2, d1xmid2
    complexed with atp, mg

Details for d1xmie_

PDB Entry: 1xmi (more details), 2.25 Å

PDB Description: crystal structure of human f508a nbd1 domain with atp
PDB Compounds: (E:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d1xmie_:

Sequence, based on SEQRES records: (download)

>d1xmie_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfki
ergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniia
gvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdadl
ylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfyg
tfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfsl

Sequence, based on observed residues (ATOM records): (download)

>d1xmie_ c.37.1.12 (E:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweegfgelfeksfsnfsllgtpvlkdinfkiergqllavagstgagkt
sllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvikacq
leediskfaekdnivlgeggitlsggqrarislaravykdadlylldspfgyldvlteke
ifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklm
gcdsfdqfsaerrnsiltetlrrfsl

SCOPe Domain Coordinates for d1xmie_:

Click to download the PDB-style file with coordinates for d1xmie_.
(The format of our PDB-style files is described here.)

Timeline for d1xmie_: