SCOPe 2.08: Domain d1xmic_: 1xmi C:

Lineage for d1xmic_ (1xmi C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
   Uniprot P13569 389-671

8. Domain d1xmic_: 1xmi C: [115491]
   Other proteins in same PDB: d1xmia2, d1xmib2, d1xmid2
   complexed with atp, mg

Details for d1xmic_

PDB Entry: 1xmi, 2.25 Å

PDB Description: crystal structure of human f508a nbd1 domain with atp

PDB Compounds: (C:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d1xmic_:

Sequence, based on SEQRES records:

>d1xmic_ c.37.1.12 (C:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfki
ergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniia
gvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdadl
ylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfyg
tfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfsl

Sequence, based on observed residues (ATOM records):

>d1xmic_ c.37.1.12 (C:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweegfgelfekakqnsfsnfsllgtpvlkdinfkiergqllavagstg
agktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvi
kacqleediskfaekdnivlgeggitlsggqrarislaravykdadlylldspfgyldvl
tekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfs
sklmgcdsfdqfsaerrnsiltetlrrfsl

Timeline for d1xmic_:

• d1xmic_ first appeared in SCOP 1.71
  
• d1xmic_ appears in SCOPe 2.07