PDB entry 1xmi

View 1xmi on RCSB PDB site
Description: Crystal structure of human F508A NBD1 domain with ATP
Class: membrane protein, hydrolase
Keywords: CFTR; NBD1 domain; F508A; cystic fibrosis; nucleotide-binding domain 1, MEMBRANE PROTEIN, HYDROLASE
Deposited on 2004-10-02, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569 (0-End)
      • cloning artifact (0)
      • engineered (41)
      • engineered (120)
      • engineered (279)
    Domains in SCOPe 2.07: d1xmia1, d1xmia2
  • Chain 'B':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569 (0-End)
      • cloning artifact (0)
      • engineered (41)
      • engineered (120)
      • engineered (279)
    Domains in SCOPe 2.07: d1xmib1, d1xmib2
  • Chain 'C':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569
      • engineered (41)
      • engineered (120)
      • engineered (279)
    Domains in SCOPe 2.07: d1xmic_
  • Chain 'D':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569 (0-End)
      • cloning artifact (0)
      • engineered (41)
      • engineered (120)
      • engineered (279)
    Domains in SCOPe 2.07: d1xmid1, d1xmid2
  • Chain 'E':
    Compound: Cystic fibrosis transmembrane conductance regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13569
      • engineered (41)
      • engineered (120)
      • engineered (279)
    Domains in SCOPe 2.07: d1xmie_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmiA (A:)
    sttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfk
    iergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikenii
    agvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdad
    lylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfy
    gtfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfslegdapvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmiA (A:)
    sttevvmenvtafweegfgelfeksfsnfsllgtpvlkdinfkiergqllavagstgagk
    tsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvikac
    qleediskfaekdnivlgeggitlsggqrarislaravykdadlylldspfgyldvltek
    eifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfsskl
    mgcdsfdqfsaerrnsiltetlrrfsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmiB (B:)
    sttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfk
    iergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikenii
    agvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdad
    lylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfy
    gtfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfslegdapvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmiB (B:)
    sttevvmenvtafweegfgelfekaksfsnfsllgtpvlkdinfkiergqllavagstga
    gktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvik
    acqleediskivltlsggqrarislaravykdadlylldspfgyldvltekeifescvck
    lmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmgcdsfdqf
    saerrnsiltetlrrfsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xmiC (C:)
    sttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfk
    iergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikenii
    agvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdad
    lylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfy
    gtfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfslegdapvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmiC (C:)
    ttevvmenvtafweegfgelfekakqnsfsnfsllgtpvlkdinfkiergqllavagstg
    agktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvi
    kacqleediskfaekdnivlgeggitlsggqrarislaravykdadlylldspfgyldvl
    tekeifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfs
    sklmgcdsfdqfsaerrnsiltetlrrfsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xmiD (D:)
    sttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfk
    iergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikenii
    agvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdad
    lylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfy
    gtfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfslegdapvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmiD (D:)
    sttevvmenvtafweegfgelfedslsfsnfsllgtpvlkdinfkiergqllavagstga
    gktsllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvik
    acqleediskfaekdnivlgeitlsggqrarislaravykdadlylldspfgyldvltek
    eifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfsskl
    mgcdsfdqfsaerrnsiltetlrrfsle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xmiE (E:)
    sttevvmenvtafweegfgelfekakqnnnnrktsngddslsfsnfsllgtpvlkdinfk
    iergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqfswimpgtikenii
    agvsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdad
    lylldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfy
    gtfselqnlqpdfssklmgcdsfdqfsaerrnsiltetlrrfslegdapvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmiE (E:)
    ttevvmenvtafweegfgelfeksfsnfsllgtpvlkdinfkiergqllavagstgagkt
    sllmmimgelepsegkikhsgrisfcsqfswimpgtikeniiagvsydeyryrsvikacq
    leediskfaekdnivlgeggitlsggqrarislaravykdadlylldspfgyldvlteke
    ifescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklm
    gcdsfdqfsaerrnsiltetlrrfsl