SCOPe 2.06: Domain d1wuea2: 1wue A:1001-1126

Lineage for d1wuea2 (1wue A:1001-1126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Enterococcus faecalis [TaxId:1351] [117925] (1 PDB entry)
   Uniprot Q838J7; EF0450; protein assignment by sequence similarity

8. Domain d1wuea2: 1wue A:1001-1126 [114893]
   Other proteins in same PDB: d1wuea1, d1wuea3, d1wueb1, d1wueb3
   Structural genomics target

Details for d1wuea2

PDB Entry: 1wue, 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583

PDB Compounds: (A:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d1wuea2:

Sequence; same for both SEQRES and ATOM records:

>d1wuea2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]}
mniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvqet
lvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqksl
teffgp

Timeline for d1wuea2:

• d1wuea2 first appeared in SCOP 1.71
  
• d1wuea2 appears in SCOPe 2.05
  
• d1wuea2 appears in SCOPe 2.07
  
• d1wuea2 appears in the current release, SCOPe 2.08