![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein N-acylamino acid racemase [110937] (4 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [117925] (1 PDB entry) Uniprot Q838J7; EF0450; protein assignment by sequence similarity |
![]() | Domain d1wuea2: 1wue A:1001-1126 [114893] Other proteins in same PDB: d1wuea1, d1wuea3, d1wueb1, d1wueb3 Structural genomics target |
PDB Entry: 1wue (more details), 2.1 Å
SCOPe Domain Sequences for d1wuea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wuea2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} mniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvqet lvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqksl teffgp
Timeline for d1wuea2: