Lineage for d1wuea2 (1wue A:1001-1126)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602981Protein N-acylamino acid racemase [110937] (4 species)
  7. 603012Species Enterococcus faecalis [TaxId:1351] [117925] (1 PDB entry)
  8. 603013Domain d1wuea2: 1wue A:1001-1126 [114893]
    Other proteins in same PDB: d1wuea1, d1wueb1

Details for d1wuea2

PDB Entry: 1wue (more details), 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583

SCOP Domain Sequences for d1wuea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuea2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Enterococcus faecalis}
mniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvqet
lvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqksl
teffgp

SCOP Domain Coordinates for d1wuea2:

Click to download the PDB-style file with coordinates for d1wuea2.
(The format of our PDB-style files is described here.)

Timeline for d1wuea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wuea1