Lineage for d1wuea2 (1wue A:1001-1126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554695Protein N-acylamino acid racemase [110937] (4 species)
  7. 2554734Species Enterococcus faecalis [TaxId:1351] [117925] (1 PDB entry)
    Uniprot Q838J7; EF0450; protein assignment by sequence similarity
  8. 2554735Domain d1wuea2: 1wue A:1001-1126 [114893]
    Other proteins in same PDB: d1wuea1, d1wuea3, d1wueb1, d1wueb3
    Structural genomics target

Details for d1wuea2

PDB Entry: 1wue (more details), 2.1 Å

PDB Description: crystal structure of protein gi:29375081, unknown member of enolase superfamily from enterococcus faecalis v583
PDB Compounds: (A:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d1wuea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuea2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]}
mniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvqet
lvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqksl
teffgp

SCOPe Domain Coordinates for d1wuea2:

Click to download the PDB-style file with coordinates for d1wuea2.
(The format of our PDB-style files is described here.)

Timeline for d1wuea2: