Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries) Uniprot O15530 409-550 |
Domain d1w1ha_: 1w1h A: [114076] Other proteins in same PDB: d1w1hb2 complexed with gol, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1w1h (more details), 1.45 Å
SCOPe Domain Sequences for d1w1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} snieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkgl farrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdps gnahkwcrkiqevwrqryqshpdaavq
Timeline for d1w1ha_:
View in 3D Domains from other chains: (mouse over for more information) d1w1hb1, d1w1hb2, d1w1hc_, d1w1hd_ |