Lineage for d1w1ha_ (1w1h A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563844Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)
  7. 563845Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)
  8. 563846Domain d1w1ha_: 1w1h A: [114076]

Details for d1w1ha_

PDB Entry: 1w1h (more details), 1.45 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain

SCOP Domain Sequences for d1w1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens)}
snieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkgl
farrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdps
gnahkwcrkiqevwrqryqshpdaavq

SCOP Domain Coordinates for d1w1ha_:

Click to download the PDB-style file with coordinates for d1w1ha_.
(The format of our PDB-style files is described here.)

Timeline for d1w1ha_: