Lineage for d1w1hd_ (1w1h D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803068Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)
  7. 2803069Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)
    Uniprot O15530 409-550
  8. 2803073Domain d1w1hd_: 1w1h D: [114079]
    Other proteins in same PDB: d1w1hb2
    complexed with gol, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1w1hd_

PDB Entry: 1w1h (more details), 1.45 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain
PDB Compounds: (D:) 3-phosphoinositide dependent protein kinase-1

SCOPe Domain Sequences for d1w1hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1hd_ b.55.1.1 (D:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}
ieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkglfa
rrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdpsgn
ahkwcrkiqevwrqryq

SCOPe Domain Coordinates for d1w1hd_:

Click to download the PDB-style file with coordinates for d1w1hd_.
(The format of our PDB-style files is described here.)

Timeline for d1w1hd_: