PDB entry 1w1h

View 1w1h on RCSB PDB site
Description: crystal structure of the pdk1 pleckstrin homology (ph) domain
Class: transferase
Keywords: pdk1, phosphoinositide dependent protein kinase 1, pkb, pleckstrin homology domain, inositol phosphate, phosphoinositide, signal transduction, pi3-kinase serine/threonine protein kinase, transferase
Deposited on 2004-06-21, released 2004-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.157
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W1H
    • Uniprot O15530 (Start-150)
    Domains in SCOPe 2.07: d1w1ha_
  • Chain 'B':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W1H (0-2)
    • Uniprot O15530 (3-150)
    Domains in SCOPe 2.07: d1w1hb1, d1w1hb2
  • Chain 'C':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1hc_
  • Chain 'D':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w1hd_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w1hA (A:)
    gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
    rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
    mdpsgnahkwcrkiqevwrqryqshpdaavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1hA (A:)
    snieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkgl
    farrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdps
    gnahkwcrkiqevwrqryqshpdaavq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w1hB (B:)
    gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
    rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
    mdpsgnahkwcrkiqevwrqryqshpdaavq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w1hC (C:)
    gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
    rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
    mdpsgnahkwcrkiqevwrqryqshpdaavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1hC (C:)
    nieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkglf
    arrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdpsg
    nahkwcrkiqevwrqryq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w1hD (D:)
    gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
    rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
    mdpsgnahkwcrkiqevwrqryqshpdaavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w1hD (D:)
    ieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkglfa
    rrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdpsgn
    ahkwcrkiqevwrqryq