SCOPe 2.07: Domain d1w1hb1: 1w1h B:409-556

Lineage for d1w1hb1 (1w1h B:409-556)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 protein domains)
   Pfam PF00169

6. Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)
   Uniprot O15530 409-550

8. Domain d1w1hb1: 1w1h B:409-556 [114077]
   Other proteins in same PDB: d1w1hb2
   complexed with gol, so4

Details for d1w1hb1

PDB Entry: 1w1h, 1.45 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain

PDB Compounds: (B:) 3-phosphoinositide dependent protein kinase-1

SCOPe Domain Sequences for d1w1hb1:

Sequence; same for both SEQRES and ATOM records:

>d1w1hb1 b.55.1.1 (B:409-556) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}
gsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkg
lfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdp
sgnahkwcrkiqevwrqryqshpdaavq

Timeline for d1w1hb1:

• d1w1hb1 first appeared in SCOP 1.71, called d1w1hb_
  
• d1w1hb1 appears in SCOPe 2.06