| Class b: All beta proteins [48724] (180 folds) |
| Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
| Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
| Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries) Uniprot O15530 409-550 |
| Domain d1w1hb1: 1w1h B:409-556 [114077] Other proteins in same PDB: d1w1hb2 complexed with gol, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1w1h (more details), 1.45 Å
SCOPe Domain Sequences for d1w1hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1hb1 b.55.1.1 (B:409-556) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}
gsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkg
lfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdp
sgnahkwcrkiqevwrqryqshpdaavq
Timeline for d1w1hb1: