SCOPe 2.08: Domain d1v7la_: 1v7l A:

Lineage for d1v7la_ (1v7l A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
   Pfam PF00694; permutation of the domain order in the proteins containing this family domain

6. Protein Isopropylmalate isomerase LeuD [117454] (1 species)
   3-isopropylmalate dehydratase small subunit

7. Species Pyrococcus horikoshii [TaxId:53953] [117455] (1 PDB entry)
   Uniprot O59393

8. Domain d1v7la_: 1v7l A: [113562]

Details for d1v7la_

PDB Entry: 1v7l, 1.98 Å

PDB Description: Structure of 3-isopropylmalate isomerase small subunit from Pyrococcus horikoshii

PDB Compounds: (A:) 3-isopropylmalate dehydratase small subunit

SCOPe Domain Sequences for d1v7la_:

Sequence; same for both SEQRES and ATOM records:

>d1v7la_ c.8.2.1 (A:) Isopropylmalate isomerase LeuD {Pyrococcus horikoshii [TaxId: 53953]}
mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
etgevrkgdeilmfepledflleivreggileyirrrgdlci

Timeline for d1v7la_:

• d1v7la_ first appeared in SCOP 1.71
  
• d1v7la_ appears in SCOPe 2.07