Lineage for d1v7la_ (1v7l A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577204Superfamily c.8.2: LeuD-like [52016] (1 family) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 577205Family c.8.2.1: LeuD-like [52017] (3 proteins)
    Pfam 00694; permutation of the domain order in the proteins containing this family domain
  6. 577228Protein Isopropylmalate isomerase LeuD [117454] (1 species)
    3-isopropylmalate dehydratase small subunit
  7. 577229Species Pyrococcus horikoshii [TaxId:70601] [117455] (1 PDB entry)
  8. 577230Domain d1v7la_: 1v7l A: [113562]

Details for d1v7la_

PDB Entry: 1v7l (more details), 1.98 Å

PDB Description: Structure of 3-isopropylmalate isomerase small subunit from Pyrococcus horikoshii

SCOP Domain Sequences for d1v7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7la_ c.8.2.1 (A:) Isopropylmalate isomerase LeuD {Pyrococcus horikoshii}
mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
etgevrkgdeilmfepledflleivreggileyirrrgdlci

SCOP Domain Coordinates for d1v7la_:

Click to download the PDB-style file with coordinates for d1v7la_.
(The format of our PDB-style files is described here.)

Timeline for d1v7la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v7lb_