PDB entry 1v7l

View 1v7l on RCSB PDB site
Description: Structure of 3-isopropylmalate isomerase small subunit from Pyrococcus horikoshii
Class: lyase
Keywords: beta barrel, lyase
Deposited on 2003-12-18, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydratase small subunit
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1724
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v7la_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydratase small subunit
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH1724
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v7lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v7lA (A:)
    mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
    fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
    etgevrkgdeilmfepledflleivreggileyirrrgdlcir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7lA (A:)
    mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
    fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
    etgevrkgdeilmfepledflleivreggileyirrrgdlci
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7lB (B:)
    mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
    fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
    etgevrkgdeilmfepledflleivreggileyirrrgdlcir