Lineage for d1v7lb_ (1v7l B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
    Pfam PF00694; permutation of the domain order in the proteins containing this family domain
  6. Protein Isopropylmalate isomerase LeuD [117454] (1 species)
    3-isopropylmalate dehydratase small subunit
  7. Species Pyrococcus horikoshii [TaxId:53953] [117455] (1 PDB entry)
    Uniprot O59393
  8. Domain d1v7lb_: 1v7l B: [113563]

Details for d1v7lb_

PDB Entry: 1v7l (more details), 1.98 Å

PDB Description: Structure of 3-isopropylmalate isomerase small subunit from Pyrococcus horikoshii
PDB Compounds: (B:) 3-isopropylmalate dehydratase small subunit

SCOPe Domain Sequences for d1v7lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7lb_ c.8.2.1 (B:) Isopropylmalate isomerase LeuD {Pyrococcus horikoshii [TaxId: 53953]}
mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn
fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw
etgevrkgdeilmfepledflleivreggileyirrrgdlcir

SCOPe Domain Coordinates for d1v7lb_ are not available.

Timeline for d1v7lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v7la_