![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
![]() | Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
![]() | Protein Isopropylmalate isomerase LeuD [117454] (1 species) 3-isopropylmalate dehydratase small subunit |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [117455] (1 PDB entry) Uniprot O59393 |
![]() | Domain d1v7lb_: 1v7l B: [113563] |
PDB Entry: 1v7l (more details), 1.98 Å
SCOPe Domain Sequences for d1v7lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7lb_ c.8.2.1 (B:) Isopropylmalate isomerase LeuD {Pyrococcus horikoshii [TaxId: 53953]} mittgkvwkfgddistdeitpgrynltkdpkelakiafievrpdfarnvrpgdvvvagkn fgigssresaalalkalgiagviaesfgrifyrnainigiplllgkteglkdgdlvtvnw etgevrkgdeilmfepledflleivreggileyirrrgdlcir
Timeline for d1v7lb_: