Lineage for d1u8rh1 (1u8r H:1-64)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
    Uniprot Q50495
  8. Domain d1u8rh1: 1u8r H:1-64 [113183]
    Other proteins in same PDB: d1u8ra2, d1u8ra3, d1u8rb2, d1u8rb3, d1u8rc2, d1u8rc3, d1u8rd2, d1u8rd3, d1u8rg2, d1u8rg3, d1u8rh2, d1u8rh3, d1u8ri2, d1u8ri3, d1u8rj2, d1u8rj3
    protein/DNA complex; complexed with co, na

Details for d1u8rh1

PDB Entry: 1u8r (more details), 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions
PDB Compounds: (H:) iron-dependent repressor ider

SCOPe Domain Sequences for d1u8rh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8rh1 a.4.5.24 (H:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
hlel

SCOPe Domain Coordinates for d1u8rh1 are not available.

Timeline for d1u8rh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8rh2, d1u8rh3