![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein Iron-dependent regulator IdeR [46885] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) Uniprot Q50495 |
![]() | Domain d1u8rc1: 1u8r C:1-64 [113174] Other proteins in same PDB: d1u8ra2, d1u8ra3, d1u8rb2, d1u8rb3, d1u8rc2, d1u8rc3, d1u8rd2, d1u8rd3, d1u8rg2, d1u8rg3, d1u8rh2, d1u8rh3, d1u8ri2, d1u8ri3, d1u8rj2, d1u8rj3 protein/DNA complex; complexed with co, na |
PDB Entry: 1u8r (more details), 2.75 Å
SCOPe Domain Sequences for d1u8rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u8rc1 a.4.5.24 (C:1-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr hlel
Timeline for d1u8rc1: