SCOPe 2.08: Domain d1u8rd2: 1u8r D:65-141

Lineage for d1u8rd2 (1u8r D:65-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Iron-dependent regulator [47983] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
   Uniprot Q50495

8. Domain d1u8rd2: 1u8r D:65-141 [113178]
   Other proteins in same PDB: d1u8ra1, d1u8ra3, d1u8rb1, d1u8rb3, d1u8rc1, d1u8rc3, d1u8rd1, d1u8rd3, d1u8rg1, d1u8rg3, d1u8rh1, d1u8rh3, d1u8ri1, d1u8ri3, d1u8rj1, d1u8rj3
   protein/DNA complex; complexed with co, na

Details for d1u8rd2

PDB Entry: 1u8r, 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions

PDB Compounds: (D:) iron-dependent repressor ider

SCOPe Domain Sequences for d1u8rd2:

Sequence; same for both SEQRES and ATOM records:

>d1u8rd2 a.76.1.1 (D:65-141) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgvg

Timeline for d1u8rd2:

• d1u8rd2 first appeared in SCOP 1.71
  
• d1u8rd2 appears in SCOPe 2.07