Lineage for d1u8rd2 (1u8r D:65-141)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718819Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2718855Protein Iron-dependent regulator [47983] (1 species)
  7. 2718856Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
    Uniprot Q50495
  8. 2718870Domain d1u8rd2: 1u8r D:65-141 [113178]
    Other proteins in same PDB: d1u8ra1, d1u8ra3, d1u8rb1, d1u8rb3, d1u8rc1, d1u8rc3, d1u8rd1, d1u8rd3, d1u8rg1, d1u8rg3, d1u8rh1, d1u8rh3, d1u8ri1, d1u8ri3, d1u8rj1, d1u8rj3
    protein/DNA complex; complexed with co, na

Details for d1u8rd2

PDB Entry: 1u8r (more details), 2.75 Å

PDB Description: Crystal Structure of an IdeR-DNA Complex Reveals a Conformational Change in Activated IdeR for Base-specific Interactions
PDB Compounds: (D:) iron-dependent repressor ider

SCOPe Domain Sequences for d1u8rd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8rd2 a.76.1.1 (D:65-141) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipgldelgvg

SCOPe Domain Coordinates for d1u8rd2:

Click to download the PDB-style file with coordinates for d1u8rd2.
(The format of our PDB-style files is described here.)

Timeline for d1u8rd2: