| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
| Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (8 PDB entries) Uniprot P07342 84-687 |
| Domain d1t9ab2: 1t9a B:89-263 [112332] Other proteins in same PDB: d1t9aa1, d1t9aa3, d1t9ab1, d1t9ab3 complexed with 1tb, fad, k, mg, p23, yf3, yf4 |
PDB Entry: 1t9a (more details), 2.59 Å
SCOPe Domain Sequences for d1t9ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9ab2 c.36.1.5 (B:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgaghmaeg
yarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqeadvvg
isrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
Timeline for d1t9ab2: