Lineage for d1t9ab1 (1t9a B:281-460)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862632Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2862633Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2862634Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (8 PDB entries)
    Uniprot P07342 84-687
  8. 2862650Domain d1t9ab1: 1t9a B:281-460 [112331]
    Other proteins in same PDB: d1t9aa2, d1t9aa3, d1t9ab2, d1t9ab3
    complexed with 1tb, fad, k, mg, p23, yf3, yf4

Details for d1t9ab1

PDB Entry: 1t9a (more details), 2.59 Å

PDB Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl
PDB Compounds: (B:) Acetolactate synthase, mitochondrial

SCOPe Domain Sequences for d1t9ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ab1 c.31.1.3 (B:281-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgs
fdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraaaegr
ggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypy

SCOPe Domain Coordinates for d1t9ab1:

Click to download the PDB-style file with coordinates for d1t9ab1.
(The format of our PDB-style files is described here.)

Timeline for d1t9ab1: