PDB entry 1t9a

View 1t9a on RCSB PDB site
Description: Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl
Class: transferase
Keywords: acetohydroxyacid synthase, acetolactate synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor, tribenuron methyl, transferase
Deposited on 2004-05-16, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t9aa1, d1t9aa2, d1t9aa3
  • Chain 'B':
    Compound: Acetolactate synthase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ILV2, SMR1, YMR108W, YM9718.07
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t9ab1, d1t9ab2, d1t9ab3
  • Heterogens: K, MG, 1TB, YF3, FAD, P23, YF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t9aA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9aA (A:)
    dmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgag
    hmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqe
    advvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
    tkttlptsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqip
    vtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfap
    earraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaq
    inkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtw
    rnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpv
    kililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklk
    efvstkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t9aB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t9aB (B:)
    dmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqgag
    hmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafqe
    advvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpip
    tkttlpqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvttt
    lqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearr
    aaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkw
    kkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnph
    tfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkili
    lnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvs
    tkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh