Lineage for d1sy7a1 (1sy7 A:553-736)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2118071Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 2118072Protein Catalase, C-terminal domain [52329] (2 species)
  7. 2118135Species Fungus (Neurospora crassa) [TaxId:5141] [117483] (1 PDB entry)
    Uniprot Q9C168 68-765
  8. 2118136Domain d1sy7a1: 1sy7 A:553-736 [112161]
    complexed with hdd, hem

Details for d1sy7a1

PDB Entry: 1sy7 (more details), 1.75 Å

PDB Description: crystal structure of the catalase-1 from neurospora crassa, native structure at 1.75a resolution.
PDB Compounds: (A:) Catalase 1

SCOPe Domain Sequences for d1sy7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Fungus (Neurospora crassa) [TaxId: 5141]}
iksrrvaiiiadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegf
rstmvdaifipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvt
vsseaevhesygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhs
miay

SCOPe Domain Coordinates for d1sy7a1:

Click to download the PDB-style file with coordinates for d1sy7a1.
(The format of our PDB-style files is described here.)

Timeline for d1sy7a1: