Lineage for d1sy7a1 (1sy7 A:553-736)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579489Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 579661Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 579662Protein Catalase, C-terminal domain [52329] (2 species)
  7. 579720Species Neurospora crassa [TaxId:5141] [117483] (1 PDB entry)
  8. 579721Domain d1sy7a1: 1sy7 A:553-736 [112161]

Details for d1sy7a1

PDB Entry: 1sy7 (more details), 1.75 Å

PDB Description: crystal structure of the catalase-1 from neurospora crassa, native structure at 1.75a resolution.

SCOP Domain Sequences for d1sy7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa}
iksrrvaiiiadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegf
rstmvdaifipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvt
vsseaevhesygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhs
miay

SCOP Domain Coordinates for d1sy7a1:

Click to download the PDB-style file with coordinates for d1sy7a1.
(The format of our PDB-style files is described here.)

Timeline for d1sy7a1: