Lineage for d1sy7a1 (1sy7 A:553-736)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein) Protein Catalase, C-terminal domain [52329] (2 species) 
Species Fungus (Neurospora crassa) [TaxId:5141] [117483] (1 PDB entry)
Uniprot Q9C168 68-765
Domain d1sy7a1: 1sy7 A:553-736 [112161]
complexed with hdd, hem
Details for d1sy7a1
PDB Entry: 1sy7 (more details), 1.75 Å
PDB Description: crystal structure of the catalase-1 from neurospora crassa, native structure at 1.75a resolution.
PDB Compounds: (A:) Catalase 1SCOPe Domain Sequences for d1sy7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Fungus (Neurospora crassa) [TaxId: 5141]}
iksrrvaiiiadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegf
rstmvdaifipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvt
vsseaevhesygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhs
miay
SCOPe Domain Coordinates for d1sy7a1:
Click to download the PDB-style file with coordinates for d1sy7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sy7a1:
- d1sy7a1 first appeared in SCOP 1.71
- d1sy7a1 appears in SCOPe 2.07
View in 3D
