PDB entry 1sy7

View 1sy7 on RCSB PDB site
Description: Crystal structure of the catalase-1 from Neurospora crassa, native structure at 1.75A resolution.
Class: oxidoreductase
Keywords: Catalase, heme oxidation, singlet oxygen, Neurospora crassa, OXIDOREDUCTASE
Deposited on 2004-04-01, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase 1
    Species: Neurospora crassa [TaxId:5141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sy7a1
  • Chain 'B':
    Compound: Catalase 1
    Species: Neurospora crassa [TaxId:5141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sy7b1
  • Heterogens: HDD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sy7A (A:)
    skkvddlknefketdksarlttdygvkqttaddwlrivsddkigpslledpfarerimrf
    dheripervvhargsgafgkfkvyesasdltmapvltdtsretpvfvrfstvlgsrgsad
    tvrdvrgfavkfyteegnwdlvgnnipvffiqdaikfpdvihagkpephnevpqaqsahn
    nfwdfqfnhteathmftwamsdraiprslrmmqgfgvntytlinaqgkrhfvkfhwtpel
    gvhslvwdealklagqdpdfhrkdlweaiengaypkwkfgiqaiaeedehkfdfdildat
    kiwpedlvpvryigemelnrnpdeffpqteqiafctshvvngigfsddpllqgrnfsyfd
    tqisrlgvnfqelpinrpvcpvmnfnrdgamrhtisrgtvnyypnrfdacppaslkeggy
    leyaqkvagikararsakfkehfsqaqlfynsmspiekqhminafgfeldhcedpvvygr
    mvqrladidlglaqtiaemvggeaptttnhpnhgrktinlsqtefppatptiksrrvaii
    iadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegfrstmvdaif
    ipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvtvsseaevhe
    sygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhsmiay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sy7A (A:)
    arlttdygvkqttaddwlrivsddkigpslledpfarerimrfdheripervvhargsga
    fgkfkvyesasdltmapvltdtsretpvfvrfstvlgsrgsadtvrdvrgfavkfyteeg
    nwdlvgnnipvffiqdaikfpdvihagkpephnevpqaqsahnnfwdfqfnhteathmft
    wamsdraiprslrmmqgfgvntytlinaqgkrhfvkfhwtpelgvhslvwdealklagqd
    pdfhrkdlweaiengaypkwkfgiqaiaeedehkfdfdildatkiwpedlvpvryigeme
    lnrnpdeffpqteqiafctshvvngigfsddpllqgrnfsyfdtqisrlgvnfqelpinr
    pvcpvmnfnrdgamrhtisrgtvnyypnrfdacppaslkeggyleyaqkvagikararsa
    kfkehfsqaqlfynsmspiekqhminafgfeldhcedpvvygrmvqrladidlglaqtia
    emvggeaptttnhpnhgrktinlsqtefppatptiksrrvaiiiadgydnvaydaayaai
    sanqaiplvigprrskvtaangstvqphhhlegfrstmvdaifipggakaaetlskngra
    lhwireafghlkaigatgeavdlvakaialpqvtvsseaevhesygvvtlkkvkpesftd
    avkiakgaagflgeffyaiaqhrnwdreldglhsmiay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sy7B (B:)
    skkvddlknefketdksarlttdygvkqttaddwlrivsddkigpslledpfarerimrf
    dheripervvhargsgafgkfkvyesasdltmapvltdtsretpvfvrfstvlgsrgsad
    tvrdvrgfavkfyteegnwdlvgnnipvffiqdaikfpdvihagkpephnevpqaqsahn
    nfwdfqfnhteathmftwamsdraiprslrmmqgfgvntytlinaqgkrhfvkfhwtpel
    gvhslvwdealklagqdpdfhrkdlweaiengaypkwkfgiqaiaeedehkfdfdildat
    kiwpedlvpvryigemelnrnpdeffpqteqiafctshvvngigfsddpllqgrnfsyfd
    tqisrlgvnfqelpinrpvcpvmnfnrdgamrhtisrgtvnyypnrfdacppaslkeggy
    leyaqkvagikararsakfkehfsqaqlfynsmspiekqhminafgfeldhcedpvvygr
    mvqrladidlglaqtiaemvggeaptttnhpnhgrktinlsqtefppatptiksrrvaii
    iadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegfrstmvdaif
    ipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvtvsseaevhe
    sygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhsmiay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sy7B (B:)
    arlttdygvkqttaddwlrivsddkigpslledpfarerimrfdheripervvhargsga
    fgkfkvyesasdltmapvltdtsretpvfvrfstvlgsrgsadtvrdvrgfavkfyteeg
    nwdlvgnnipvffiqdaikfpdvihagkpephnevpqaqsahnnfwdfqfnhteathmft
    wamsdraiprslrmmqgfgvntytlinaqgkrhfvkfhwtpelgvhslvwdealklagqd
    pdfhrkdlweaiengaypkwkfgiqaiaeedehkfdfdildatkiwpedlvpvryigeme
    lnrnpdeffpqteqiafctshvvngigfsddpllqgrnfsyfdtqisrlgvnfqelpinr
    pvcpvmnfnrdgamrhtisrgtvnyypnrfdacppaslkeggyleyaqkvagikararsa
    kfkehfsqaqlfynsmspiekqhminafgfeldhcedpvvygrmvqrladidlglaqtia
    emvggeaptttnhpnhgrktinlsqtefppatptiksrrvaiiiadgydnvaydaayaai
    sanqaiplvigprrskvtaangstvqphhhlegfrstmvdaifipggakaaetlskngra
    lhwireafghlkaigatgeavdlvakaialpqvtvsseaevhesygvvtlkkvkpesftd
    avkiakgaagflgeffyaiaqhrnwdreldglhsmiay