![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein) |
![]() | Protein Catalase, C-terminal domain [52329] (2 species) |
![]() | Species Fungus (Neurospora crassa) [TaxId:5141] [117483] (1 PDB entry) Uniprot Q9C168 68-765 |
![]() | Domain d1sy7a1: 1sy7 A:553-736 [112161] complexed with hdd, hem |
PDB Entry: 1sy7 (more details), 1.75 Å
SCOPe Domain Sequences for d1sy7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Fungus (Neurospora crassa) [TaxId: 5141]} iksrrvaiiiadgydnvaydaayaaisanqaiplvigprrskvtaangstvqphhhlegf rstmvdaifipggakaaetlskngralhwireafghlkaigatgeavdlvakaialpqvt vsseaevhesygvvtlkkvkpesftdavkiakgaagflgeffyaiaqhrnwdreldglhs miay
Timeline for d1sy7a1: